PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC036920.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 122aa    MW: 13632.7 Da    PI: 10.6528
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC036920.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.11.9e-2868117251
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                   prlrWtpeLH+rF  ave+LGG+++AtPk +l++m++kgLt++hvkSHLQ
  EcC036920.10  68 PRLRWTPELHQRFTLAVERLGGEDRATPKMVLQIMGMKGLTISHVKSHLQ 117
                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.9564122IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2764117IPR009057Homeodomain-like
SuperFamilySSF466895.2E-1465118IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2268118IPR006447Myb domain, plants
PfamPF002498.6E-869118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MVHGEESFLK RSDSPSSSVV IVDGPSSESS DLRGNRMRDH GTLALLPLGT INQQQLSPVR  60
PYVRSKTPRL RWTPELHQRF TLAVERLGGE DRATPKMVLQ IMGMKGLTIS HVKSHLQVCL  120
FT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224747.11e-29PREDICTED: probable transcription factor KAN4
RefseqXP_008440000.19e-30PREDICTED: probable transcription factor KAN2 isoform X3
SwissprotQ700D91e-25MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A059CF663e-35A0A059CF66_EUCGR; Uncharacterized protein
STRINGBRADI4G26800.11e-29(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-28G2-like family protein